Difference from BioPhi

[lukatop]

Hi @prihoda,

First of all thanks for making this tool it is great and I find it very useful!

I tried running promb (which is very fast compared to BioPhi), but I am seeing difference in some outputs. I am using list of therapeutic antibodies from TheraSabDab

For one antibody, Betinukibart I see a larger difference in OAS identity, which makes a large difference in OAS percentile, ~15%.

>Betinukibart_VH
QVQLVQSGSELKKPGASVKVSCKASEYIFTNYGMNWVKQAPGQGFEWMGWIDTNTGEPTYAQGFTGRFVFSLDTSVSTAYLQISSLKAEDTATYYCANYGWGYFDYWGQGTTVTVSS
>Betinukibart_VL
DVVMTQTPPSLPVNPGEPASISCRSSQSLVHSNGYTYLHWYLQKPGQSPQLLIYKVSNHLSGVPDRFSGSGSGTDFTLKISWVEAEDVGVYFCSQSTHVPYTFGGGTKLEIK

Can you help me figuring out where is this difference coming from? I think it is difference in non-human peptides which makes me think it is something to do with a database, but I am not sure.

Thanks,
Luka