Skip to content

Lefrunila/Llamanade

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

1 Commit
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

Server is now avaialble at http://www.llamanade.app or http://35.208.211.136 if domain cannot be resolved

Send a request to zhe[dot]sang[at]icahn[dot]mssm[dot]edu if you encounter any difficulty.

Llamanade: an open-source computational pipeline for robust nanobody humanization

Zhe Sang,Yufei Xiang, Ivet Bahar and Yi Shi

University of Pittsburgh

Abstract

Nanobodies (Nbs) have recently emerged as a promising class of antibody fragments for biomedical and therapeutic applications. Despite having marked physicochemical properties, Nbs are derived from camelids and may require “humanization” to improve translational potentials for clinical trials. Here we have systematically analyzed the sequence and structural properties of Nbs based on NGS (next-generation sequencing) databases and high-resolution structures. Our analysis reveals substantial framework diversities and underscores the key differences between Nbs and human Immunoglobulin G (IgG) antibodies. We identified conserved residues that may contribute to enhanced solubility, structural stability, and antigen-binding, providing insights into Nb humanization. Based on big data analysis, we developed “Llamanade'', a user-friendly, open-source to facilitate rational humanization of Nbs. Using Nb sequence as input, Llamanade provides information on the sequence features, model structures, and optimizes solutions to humanize Nbs. The full analysis for a given Nb takes less than a minute on a local computer. To demonstrate the robustness of this tool, we applied it to successfully humanize a cohort of structurally diverse and highly potent SARS-CoV-2 neutralizing Nbs. Llamanade is freely available and will be easily accessible on a web server to support the development of a rapidly expanding repertoire of therapeutic Nbs into safe and effective trials.

for citation, please cite our paper: https://doi.org/10.1016/j.str.2021.11.006

How to run Llamanade locally:

1. Clone the git repository : git clone "https://github.com/sangzhe/Llamanade.git"
2. Make sure you have the following libraries installed in your environment:
        - HMMER(http://hmmer.org)(required by ANARCI)
        - ANARCI(https://github.com/oxpig/ANARCI)
        - NCBI Blastp(https://ftp.ncbi.nlm.nih.gov/blast/executables/blast+/LATEST) or (sudo apt-get install ncbi-blast+)
        - Bio (pip install Bio)
        - ProDy(http://prody.csb.pitt.edu/)(pip install prody)
        - Protinter(https://github.com/maxibor/protinter)
        - Modeller (requires license - https://salilab.org/modeller/)
3. Configure NanoNet
        - NanoNet is included here, please install required library accordingly.
        - NanoNet only predict CA atoms, sidechains will be constructed using pulchr. The source code is also included under NanoNet folder, please compile first and move the executable under the NanoNet folder
        - Test if NanoNet works
4. Unzip recourses.zip
5. Edit params.py
        - Varaibles in this file refer to the executables or resources, please edit accordingly especially the path for LLAMANADE. 

Run Llamanade

usage: Nb Humanization [-h] [--fa FA] [--pdb PDB] [--chain CHAIN] [--modeling {NanoNet,Modeller}]

Program for comprehensive nanobody humanization

optional arguments:
  -h, --help            show this help message and exit
  --fa FA, -f FA        sequence file of a nanobody in fasta format
  --pdb PDB, -p PDB     structure file of a nanobody in pdb format
  --chain CHAIN, -c CHAIN
                        chain of nanobody in structure file
  --modeling {NanoNet,Modeller}, -m {NanoNet,Modeller}
                        structural modeling tools

Run with a sequence in FASTA

(base) zhesang@zhe-Alienware:~/Llamanade$ python NbHumanization_main.py --fa test/Nb21.fa
Initial coordinates will be preserved.
reconstruct
/home/zhesang/Llamanade
NanoNet ended successfully, models are located in directory:'/tmp/result_zvdp6c7w/NanoNet', total time : 1.934037835104391.
1 processed
1 processed
QVQLVESGGGLVQAGGSLRLSCAVSGLGAHRVGWFRRAPGKEREFVAAIGANGGNTNYLDSVKGRFTISRDNAKNTIYLQMNSLKPQDTAVYYCAARDIETAEYTYWGQGTQVTVS:82.0931
QVQLVESGGGLVQPGGSLRLSCAASGLGAHRVGWVRRAPGKGLEFVAAIGANGGNTNYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARRDIETAEYTYWGQGTLVTVS:94.7688
result saved to /home/zhesang/Llamanade/test/result_zvdp6c7w

Run with a structure in PDB

(base) zhesang@zhe-Alienware:~/Llamanade$ python NbHumanization_main.py --pdb test/Nb20.pdb --chain C
@> 852 atoms and 1 coordinate set(s) were parsed in 0.02s.
1 processed
1 processed
QVQLVESGGGLVQAGGSLRLSCAVSGAGAHRVGWFRRAPGKEREFVAAIGASGGMTNYLDSVKGRFTISRDNAKNTIYLQMNSLKPQDTAVYYCAARDIETAEYIYWGQGTQVTVS:82.1499
QVQLVESGGGLVQPGGSLRLSCAASGAGAHRVGWFRQAPGKEREFVAAIGASGGMTNYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARRDIETAEYIYWGQGTLVTVS:92.4397
result saved to /home/zhesang/Llamanade/test/result_g5f9lf2f

About

Llamanade (archived recovery) — Open-source nanobody humanization pipeline. Original repo by sangzhe was deleted along with all forks. Preserved from Software Heritage archive.

Topics

Resources

Stars

Watchers

Forks

Releases

No releases published

Packages

 
 
 

Contributors